DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HOXA3

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001371264.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens


Alignment Length:197 Identity:51/197 - (25%)
Similarity:74/197 - (37%) Gaps:66/197 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 ASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYL 185
            :|.::|:..|...|.||....                   :|.|||:|.|||..||::|...:||
Human   171 SSSSSGESCAGDKSPPGQASS-------------------KRARTAYTSAQLVELEKEFHFNRYL 216

  Fly   186 SVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGG-------- 242
            ....|.::|..|||:|.|:|.|:||||.|:|:..:            .|..:...||        
Human   217 CRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQK------------GKGMLTSSGGQSPSRSPV 269

  Fly   243 --GAGG---------------------LGCCPSGL----SSSFSAAAAAAAAASNPCNFLTSAAA 280
              ||||                     ....|.|.    .:|:.|:..:.|....|....|:|.|
Human   270 PPGAGGYLNSMHSLVNSVPYEPQSPPPFSKPPQGTYGLPPASYPASLPSCAPPPPPQKRYTAAGA 334

  Fly   281 AA 282
            .|
Human   335 GA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
HOXA3NP_001371264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147
Antp-type hexapeptide 155..160
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 7/43 (16%)
Homeobox 195..248 CDD:395001 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 18/102 (18%)
DUF4074 378..441 CDD:404218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.