Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001371264.1 | Gene: | HOXA3 / 3200 | HGNCID: | 5104 | Length: | 443 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 51/197 - (25%) |
---|---|---|---|
Similarity: | 74/197 - (37%) | Gaps: | 66/197 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 ASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYL 185
Fly 186 SVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGG-------- 242
Fly 243 --GAGG---------------------LGCCPSGL----SSSFSAAAAAAAAASNPCNFLTSAAA 280
Fly 281 AA 282 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 26/52 (50%) |
HOXA3 | NP_001371264.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 75..147 | ||
Antp-type hexapeptide | 155..160 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 159..196 | 7/43 (16%) | |||
Homeobox | 195..248 | CDD:395001 | 26/52 (50%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 247..338 | 18/102 (18%) | |||
DUF4074 | 378..441 | CDD:404218 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 400..443 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |