DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HOXA1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_005513.2 Gene:HOXA1 / 3198 HGNCID:5099 Length:335 Species:Homo sapiens


Alignment Length:248 Identity:59/248 - (23%)
Similarity:82/248 - (33%) Gaps:105/248 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAA 121
            |.||....||            |.|...|....|.         .|:|.:.::.|.:.|....:|
Human    63 SPHHHHHHHH------------RHPQPATYQTSGN---------LGVSYSHSSCGPSYGSQNFSA 106

  Fly   122 S----GANGDRDANGG-------------SGP---------GSGGGTSGG--------------- 145
            .    ..|.:.|.:||             |.|         |..||..|.               
Human   107 PYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSL 171

  Fly   146 ------------YAEH-----------------------KLQLSKSGR--------KPRRRRTAF 167
                        :|.|                       |....|:|:        :|...||.|
Human   172 ALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNF 236

  Fly   168 THAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220
            |..||..||::|...|||:.|.|.::|.:|.|:|||||.|:||||.|.|::.:
Human   237 TTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 28/52 (54%)
HOXA1NP_005513.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..83 8/31 (26%)
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 75..203 20/136 (15%)
COG5576 176..>286 CDD:227863 34/109 (31%)
Antp-type hexapeptide 204..209 0/4 (0%)
Homeobox 233..286 CDD:365835 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..335 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.