Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005513.2 | Gene: | HOXA1 / 3198 | HGNCID: | 5099 | Length: | 335 | Species: | Homo sapiens |
Alignment Length: | 248 | Identity: | 59/248 - (23%) |
---|---|---|---|
Similarity: | 82/248 - (33%) | Gaps: | 105/248 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 SHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAA 121
Fly 122 S----GANGDRDANGG-------------SGP---------GSGGGTSGG--------------- 145
Fly 146 ------------YAEH-----------------------KLQLSKSGR--------KPRRRRTAF 167
Fly 168 THAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 28/52 (54%) |
HOXA1 | NP_005513.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 61..83 | 8/31 (26%) | |
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 | 75..203 | 20/136 (15%) | |||
COG5576 | 176..>286 | CDD:227863 | 34/109 (31%) | ||
Antp-type hexapeptide | 204..209 | 0/4 (0%) | |||
Homeobox | 233..286 | CDD:365835 | 28/52 (54%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 281..335 | 3/9 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |