Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057254.1 | Gene: | TLX2 / 3196 | HGNCID: | 5057 | Length: | 284 | Species: | Homo sapiens |
Alignment Length: | 225 | Identity: | 73/225 - (32%) |
---|---|---|---|
Similarity: | 101/225 - (44%) | Gaps: | 51/225 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 LLSHHHRRFTHHDESS--VESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLL 117
Fly 118 AAAASG---------------------ANGDRDANGGSGPGSGGGTSG----------GYAEHKL 151
Fly 152 QLSKS-------------GRKPRRR---RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLS 200
Fly 201 ETQVKTWYQNRRTKWKRQNQLRLEQLRHQA 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 28/55 (51%) |
TLX2 | NP_057254.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..50 | 17/46 (37%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 78..106 | 3/27 (11%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 139..166 | 6/26 (23%) | |||
Homeobox | 160..213 | CDD:278475 | 27/52 (52%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |