DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and TLX2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_057254.1 Gene:TLX2 / 3196 HGNCID:5057 Length:284 Species:Homo sapiens


Alignment Length:225 Identity:73/225 - (32%)
Similarity:101/225 - (44%) Gaps:51/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LLSHHHRRFTHHDESS--VESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLL 117
            :|..|:  ..||:..|  ::..||....||.|.|.|.||.|.|..|..||....|:..|.|..|.
Human     5 MLGPHN--LPHHEPISFGIDQILSGPETPGGGLGLGRGGQGHGENGAFSGGYHGASGYGPAGSLA 67

  Fly   118 AAAASG---------------------ANGDRDANGGSGPGSGGGTSG----------GYAEHKL 151
            ....|.                     |.|.....|.||.|..||.:|          .:|:.:|
Human    68 PLPGSSGVGPGGVIRVPAHRPLPVPPPAGGAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRL 132

  Fly   152 QLSKS-------------GRKPRRR---RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLS 200
            ..:.|             .|.|.:|   ||:|:.:|:..|||:|..||||:.|:|:.:|:.|.::
Human   133 TAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMT 197

  Fly   201 ETQVKTWYQNRRTKWKRQNQLRLEQLRHQA 230
            :.|||||:|||||||:||.....|..||:|
Human   198 DAQVKTWFQNRRTKWRRQTAEEREAERHRA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 28/55 (51%)
TLX2NP_057254.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 17/46 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..106 3/27 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..166 6/26 (23%)
Homeobox 160..213 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.