DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HLX

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_068777.1 Gene:HLX / 3142 HGNCID:4978 Length:488 Species:Homo sapiens


Alignment Length:365 Identity:75/365 - (20%)
Similarity:111/365 - (30%) Gaps:137/365 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PDSTAAGCQQE---LLLSHHHRRFTHHDESSVES------------CLSATRGPGSGT------- 85
            |....||..|.   |..::||    ||.:...:.            ...|.:.|.|||       
Human   101 PSEVPAGFPQRLSPLSAAYHH----HHPQQQQQQQQPQQQQPPPPPRAGALQPPASGTRVVPNPH 161

  Fly    86 GSGGGGGGGGGG---GVASGLSAAAAAAGVAAGLLAAAASGANGDRDAN---GGSGPGSG----- 139
            .||.........   |:...|||...........|....|...|.|.|.   .|..|.:|     
Human   162 HSGSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFAS 226

  Fly   140 --------------GGTSGGYAEHKLQLSKSG---------------RKPRRRRTAFTHAQLAYL 175
                          ........:|:.|.:..|               ||....|..|::.|...|
Human   227 LDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGL 291

  Fly   176 ERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRL----------------- 223
            |::|..|||::..||..:|..|.|::.|||.|:||||.||:...:.:.                 
Human   292 EKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAP 356

  Fly   224 -----------------------------------------EQLRHQATMEK-----DFVVQDGG 242
                                                     |:..||.|:.|     ..:.....
Human   357 AADGEQDERSPSRSEGEAESESSDSESLDMAPSDTERTEGSERSLHQTTVIKAPVTGALITASSA 421

  Fly   243 GAGGLGCCPSGLSSSFSAAAAAAAAASNPCNFLTSAAAAA 282
            |:||   ...|..:|||.::|::.::|:     |||..|:
Human   422 GSGG---SSGGGGNSFSFSSASSLSSSS-----TSAGCAS 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 23/52 (44%)
HLXNP_068777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..173 11/58 (19%)
Abdominal-A 227..>344 CDD:332641 29/116 (25%)
Homeobox 279..332 CDD:306543 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..488 19/131 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.