DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Lhx6

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001101307.2 Gene:Lhx6 / 311901 RGDID:1306174 Length:392 Species:Rattus norvegicus


Alignment Length:136 Identity:33/136 - (24%)
Similarity:47/136 - (34%) Gaps:29/136 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKP-RRRRTAFTHAQLAYLERKFRCQKYLSVA 188
            |..|.|..|:|....|.....        ..|..|| :|.||:||..||..::.:|.........
  Rat   220 NLKRAAENGNGLTLEGAVPSE--------QDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQ 276

  Fly   189 DRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSG 253
            ....:|:...||...::.|:||.|.:.|:...      :|.....              |..||.
  Rat   277 TLQKLADMTGLSRRVIQVWFQNCRARHKKHTP------QHPVPPS--------------GAPPSR 321

  Fly   254 LSSSFS 259
            |.||.|
  Rat   322 LPSSLS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 14/52 (27%)
Lhx6NP_001101307.2 LIM1_Lhx6 99..152 CDD:188766
LIM2_Lhx6 160..214 CDD:188768
Homeobox 252..305 CDD:395001 14/52 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.