Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005506.3 | Gene: | MNX1 / 3110 | HGNCID: | 4979 | Length: | 401 | Species: | Homo sapiens |
Alignment Length: | 236 | Identity: | 81/236 - (34%) |
---|---|---|---|
Similarity: | 98/236 - (41%) | Gaps: | 76/236 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 PG-SGTGSGGGGGGGGGGG-----------VASGLSAAAAAAGVAAGL----------------- 116
Fly 117 ---------LAAAASGANGDRDANGGSGPGSGG------------GTSGGYAEHKLQLSKSGR-- 158
Fly 159 ----------------KPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTW 207
Fly 208 YQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLG 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 30/52 (58%) |
MNX1 | NP_005506.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 37..78 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 101..120 | 9/18 (50%) | |||
Homeobox | 244..297 | CDD:278475 | 30/52 (58%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 299..401 | 9/31 (29%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |