DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Nkx6-2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001101028.1 Gene:Nkx6-2 / 309095 RGDID:1307280 Length:277 Species:Rattus norvegicus


Alignment Length:182 Identity:60/182 - (32%)
Similarity:79/182 - (43%) Gaps:32/182 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGP--- 136
            |....|.....|...|..|||..|....|:..|::|||..|..||.|.|.........|..|   
  Rat    54 LGTPHGISDILGRPVGAAGGGLLGSLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFW 118

  Fly   137 -----GS--------GGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVA 188
                 ||        |...:||.      |.|.|:|...|.| |:..|:..||:.|...|||:..
  Rat   119 PGVVQGSPWRDPRLAGSAQAGGV------LDKDGKKKHSRPT-FSGQQIFALEKTFEQTKYLAGP 176

  Fly   189 DRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQD 240
            :|:.:|.:|.::|:|||.|:|||||||::         ||.|.|......||
  Rat   177 ERARLAYSLGMTESQVKVWFQNRRTKWRK---------RHAAEMASAKKKQD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/52 (46%)
Nkx6-2NP_001101028.1 Homeobox 151..205 CDD:395001 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.