DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and nkx2.7

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_571494.1 Gene:nkx2.7 / 30694 ZFINID:ZDB-GENE-990415-179 Length:269 Species:Danio rerio


Alignment Length:152 Identity:52/152 - (34%)
Similarity:76/152 - (50%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 TSGGYAEHKLQLSKSG----RKPRRR-----RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETL 197
            |...|:      ||:|    .||::|     |..|:..|:..|||:|:.|:|||..:|..:|..|
Zfish   103 TDSSYS------SKNGETLREKPKQRLRRKPRVLFSQTQVFELERRFKQQRYLSAPERDHLALAL 161

  Fly   198 NLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAA 262
            .|:.||||.|:||||.|.|||.|.:..:|.....:....:|:||....|   .|..::.|:....
Zfish   162 KLTSTQVKIWFQNRRYKCKRQRQDKSLELAGPRRVAVPVLVRDGKPCHG---APYNVTVSYPYNN 223

  Fly   263 AAAAAASNP--CNFLTSAAAAA 282
            ...:..:||  ||| ||..:.|
Zfish   224 YYNSYGNNPYHCNF-TSVPSFA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/57 (46%)
nkx2.7NP_571494.1 COG5576 87..210 CDD:227863 41/112 (37%)
Homeobox 127..180 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.