DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Nkx3-1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001029316.1 Gene:Nkx3-1 / 305999 RGDID:1305369 Length:238 Species:Rattus norvegicus


Alignment Length:296 Identity:77/296 - (26%)
Similarity:109/296 - (36%) Gaps:125/296 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QSSK--SFLIRDLLGDLINRR---------------QTDSELELSN-DDSDIDIED----RSTPD 44
            ||.:  ||||:|:|.|...||               :.||..||.. :.|.:.:||    ||:|.
  Rat    26 QSKRLTSFLIQDILRDHAERRGGQPSTPQHQCQPDPKRDSASELDEAEGSSVTLEDPPGIRSSPT 90

  Fly    45 STAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAA 109
            .|.|..:.:.           |.|:.:..|                                   
  Rat    91 ETRAETESDA-----------HFETYLLDC----------------------------------- 109

  Fly   110 AGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKS---GRKPRRR-RTAFTHA 170
                                                  ||...||.:   .::|::| |.||:|.
  Rat   110 --------------------------------------EHTPVLSSAPQVTKQPQKRSRAAFSHT 136

  Fly   171 QLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKD 235
            |:..|||||..|||||..:|:.:|:.|.|:|||||.|:||||.|.||: ||. |.|   ..:||:
  Rat   137 QVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRR-QLS-EDL---GVLEKN 196

  Fly   236 FVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASNP 271
            ..:.          .|:....|.|.|:..:..||.|
  Rat   197 STLS----------LPTLKDDSLSRASLVSVYASYP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 31/53 (58%)
Nkx3-1NP_001029316.1 Homeobox 129..182 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.