DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and pax6a

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_009296153.1 Gene:pax6a / 30567 ZFINID:ZDB-GENE-990415-200 Length:459 Species:Danio rerio


Alignment Length:348 Identity:82/348 - (23%)
Similarity:127/348 - (36%) Gaps:113/348 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QSSKSFLIRDLLGDLINRRQTDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHHHRR---- 62
            :|..:.::::.:.|:.|...:.     .|....:.:..|..||||.   |:.:.|:|...|    
Zfish    13 ESGVASMMQNKVYDICNEGHSG-----VNQLGGVFVNGRPLPDSTR---QKIVELAHSGARPCDI 69

  Fly    63 ----FTHHD--------ESSVESCLSATRGPGSGTGSGGGGGGGGG----------GGVAS---- 101
                .||.|        |:....|:|...|....|||......||.          |.:|.    
Zfish    70 SRILQTHADAKVQVLDNENVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRE 134

  Fly   102 -------GLSAAAAAAGVAAG-----------LLAAAAS-----GANGD----RDANG-----GS 134
                   .:.....:.||...           :|...||     ||:|.    |..||     |:
Zfish   135 CPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQMGADGMYEKLRMLNGQTGTWGT 199

  Fly   135 GPGSGGGT-------------SGGYAEHKLQLSKSG-------------RKPRRRRTAFTHAQLA 173
            .||...||             |.|..|:...:|.:|             ||.:|.||:||..|:.
Zfish   200 RPGWYPGTSVPGQPNQDGCQQSDGGGENTNSISSNGEDSDETQMRLQLKRKLQRNRTSFTQEQIE 264

  Fly   174 YLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVV 238
            .||::|....|..|..|..:|..::|.|.:::.|:.|||.||:|:.:||.:  |.||:.....: 
Zfish   265 ALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQ--RRQASNSSSHI- 326

  Fly   239 QDGGGAGGLGCCPSGLSSSFSAA 261
                          .:|||||.:
Zfish   327 --------------PISSSFSTS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 19/52 (37%)
pax6aXP_009296153.1 PAX 31..169 CDD:128645 26/145 (18%)
Homeobox 255..307 CDD:306543 19/51 (37%)
Retinal 341..>459 CDD:330657
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.