DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and pax3a

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_571352.1 Gene:pax3a / 30532 ZFINID:ZDB-GENE-980526-52 Length:509 Species:Danio rerio


Alignment Length:202 Identity:55/202 - (27%)
Similarity:76/202 - (37%) Gaps:61/202 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSV 187
            |..|||.::...|       |...:|..|.|.   ||.||.||.||..||..|||.|....|..:
Zfish   193 GILGDRSSHSDEG-------SDVDSEPGLPLK---RKQRRSRTTFTAEQLEELERAFERTHYPDI 247

  Fly   188 ADRSDVAETLNLSETQVKTWYQNRRTKWKRQ---NQL---------------------------- 221
            ..|.::|:...|:|.:|:.|:.|||.:|::|   |||                            
Zfish   248 YTREELAQRAKLTEARVQVWFSNRRARWRKQAGANQLMAFNHLIPGGFPPSAMSSLQPYQLADSP 312

  Fly   222 ----RLEQLRHQAT-------MEKDFVVQDGGGAG-------GLGCCPSGLS--SSFSAAAAAAA 266
                .:.|:..|.:       :....|.|.|.|:|       ...|..||..  |.:|....||.
Zfish   313 YPPSSISQVSEQPSTVHRPQPLPPTSVHQSGLGSGPGAQEGSSAYCLSSGRHGFSGYSDGYVAAP 377

  Fly   267 AASNPCN 273
            ..:||.|
Zfish   378 GHANPVN 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 20/52 (38%)
pax3aNP_571352.1 PAX 34..159 CDD:128645
Homeobox 223..276 CDD:278475 20/52 (38%)
Pax7 350..394 CDD:289156 10/35 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.