Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571352.1 | Gene: | pax3a / 30532 | ZFINID: | ZDB-GENE-980526-52 | Length: | 509 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 55/202 - (27%) |
---|---|---|---|
Similarity: | 76/202 - (37%) | Gaps: | 61/202 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 GANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSV 187
Fly 188 ADRSDVAETLNLSETQVKTWYQNRRTKWKRQ---NQL---------------------------- 221
Fly 222 ----RLEQLRHQAT-------MEKDFVVQDGGGAG-------GLGCCPSGLS--SSFSAAAAAAA 266
Fly 267 AASNPCN 273 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 20/52 (38%) |
pax3a | NP_571352.1 | PAX | 34..159 | CDD:128645 | |
Homeobox | 223..276 | CDD:278475 | 20/52 (38%) | ||
Pax7 | 350..394 | CDD:289156 | 10/35 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |