DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and msx1a

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_571348.1 Gene:msx1a / 30527 ZFINID:ZDB-GENE-980526-312 Length:233 Species:Danio rerio


Alignment Length:142 Identity:53/142 - (37%)
Similarity:80/142 - (56%) Gaps:22/142 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKW 215
            |:..|:.|||   ||.|:.|||..||||||.::|||:|:|::.:.:|:|:|||||.|:||||.|.
Zfish   105 LRKHKTNRKP---RTPFSTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKA 166

  Fly   216 KRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAA--AAAAAASNPCN-FLTS 277
            ||..:..||:|:..|   |..:             |.....||.|.|  .|.:|.|:|.: ...:
Zfish   167 KRLQEAELEKLKMAA---KPLL-------------PPAFGISFPAGAHIPAYSAGSHPFHRHSAN 215

  Fly   278 AAAAAIFRNVGY 289
            .:...::.::||
Zfish   216 VSPVGLYTHMGY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 30/52 (58%)
msx1aNP_571348.1 Homeobox 114..167 CDD:278475 31/55 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.