DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and dbx1b

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_571253.1 Gene:dbx1b / 30416 ZFINID:ZDB-GENE-000128-11 Length:322 Species:Danio rerio


Alignment Length:68 Identity:31/68 - (45%)
Similarity:41/68 - (60%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 KPRR---RRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220
            ||||   ||..|:..|...||:.|:.|||:|..||..:|..|.|.::|||.|:||||.||:...:
Zfish   175 KPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLATKLGLKDSQVKIWFQNRRMKWRNSKE 239

  Fly   221 LRL 223
            ..|
Zfish   240 REL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 25/52 (48%)
dbx1bNP_571253.1 COG5576 <173..296 CDD:227863 31/68 (46%)
Homeobox 182..235 CDD:278475 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..266 1/5 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..322
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.