DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Hoxb1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_220896.4 Gene:Hoxb1 / 303491 RGDID:1310298 Length:297 Species:Rattus norvegicus


Alignment Length:241 Identity:68/241 - (28%)
Similarity:91/241 - (37%) Gaps:87/241 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GP------GSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAG---------------LLAAAASG 123
            ||      |...|.||.......|....||..:..|.||.:|               ..|:|...
  Rat    91 GPSQYYSMGQSEGDGGYFHPSSYGAQLGGLPDSYGAGGVGSGPYPPPQPPYGTEQTSNFASAYDL 155

  Fly   124 ANGDRDANGGSGPGS------------------------GGGTSGGYAEHKLQLSKSGRKPRRRR 164
            .:.|::::..|.|.|                        |.||.||.                 |
  Rat   156 LSEDKESSCSSEPSSLTARTFDWMKVKRNPPKTAKVSELGLGTPGGL-----------------R 203

  Fly   165 TAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQ 229
            |.||..||..||::|...||||.|.|.::|.||.|:|||||.|:||||.|.|::.          
  Rat   204 TNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKRE---------- 258

  Fly   230 ATMEKDFVVQDGG--GAGGLGCCP---SGLSSSFSAAAAAAAAASN 270
                     ::||  .||..| ||   :|.:|..||..:..|:.|:
  Rat   259 ---------REGGRVPAGPPG-CPKEAAGEASDQSACTSPEASPSS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 30/52 (58%)
Hoxb1XP_220896.4 Homeobox 203..255 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.