Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038463.2 | Gene: | RAX / 30062 | HGNCID: | 18662 | Length: | 346 | Species: | Homo sapiens |
Alignment Length: | 232 | Identity: | 65/232 - (28%) |
---|---|---|---|
Similarity: | 87/232 - (37%) | Gaps: | 69/232 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 PGSGTGSGGGGGGGGG------GGVASGLSAAAAAAGVAA--GLLAA--AASGANG--DRDANGG 133
Fly 134 SGP--------GS------------------------------GGGTSGGYAEHKLQLSKS---G 157
Fly 158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
Fly 223 LEQLRHQ-------------ATMEKDFVVQDGGGAGG 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 24/52 (46%) |
RAX | NP_038463.2 | Octapeptide motif | 33..40 | 1/6 (17%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 46..145 | 23/98 (23%) | |||
Homeobox | 140..192 | CDD:278475 | 24/51 (47%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..318 | 9/42 (21%) | |||
OAR | 319..335 | CDD:281777 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 323..336 | ||||
Nuclear localization signal. /evidence=ECO:0000255 | 329..333 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |