DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and RAX

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_038463.2 Gene:RAX / 30062 HGNCID:18662 Length:346 Species:Homo sapiens


Alignment Length:232 Identity:65/232 - (28%)
Similarity:87/232 - (37%) Gaps:69/232 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PGSGTGSGGGGGGGGG------GGVASGLSAAAAAAGVAA--GLLAA--AASGANG--DRDANGG 133
            ||.......|.....|      ||..|.|.:..|..|...  |:|..  |..||.|  :||...|
Human     4 PGCAPAMADGSFSLAGHLLRSPGGSTSRLHSIEAILGFTKDDGILGTFPAERGARGAKERDRRLG 68

  Fly   134 SGP--------GS------------------------------GGGTSGGYAEHKLQLSKS---G 157
            :.|        ||                              ..|...|.|..:.:||:.   .
Human    69 ARPACPKAPEEGSEPSPPPAPAPAPEYEAPRPYCPKEPGEARPSPGLPVGPATGEAKLSEEEQPK 133

  Fly   158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
            :|.||.||.||..||..|||.|....|..|..|.::|..:||.|.:|:.|:||||.||:||.:|.
Human   134 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLE 198

  Fly   223 LEQLRHQ-------------ATMEKDFVVQDGGGAGG 246
            :..::.|             ||:..   :..|.|:||
Human   199 VSSMKLQDSPLLSFSRSPPSATLSP---LGAGPGSGG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/52 (46%)
RAXNP_038463.2 Octapeptide motif 33..40 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..145 23/98 (23%)
Homeobox 140..192 CDD:278475 24/51 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..318 9/42 (21%)
OAR 319..335 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 323..336
Nuclear localization signal. /evidence=ECO:0000255 329..333
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.