Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_066305.2 | Gene: | TLX3 / 30012 | HGNCID: | 13532 | Length: | 291 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 62/204 - (30%) |
---|---|---|---|
Similarity: | 87/204 - (42%) | Gaps: | 49/204 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 ATRGPGSGTGSGGGGGGGGGGGVAS------GLSAAAAAAGVAAGLLAAAASG---ANGDRDANG 132
Fly 133 GSGP---------------GSGGGTSGGYAEHKLQLSK----------------------SGRKP 160
Fly 161 RRR---RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
Fly 223 LEQLRHQAT 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 27/55 (49%) |
TLX3 | NP_066305.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..56 | 9/21 (43%) | |
Homeobox | 169..223 | CDD:395001 | 27/53 (51%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |