DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Nkx1-1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_234082.6 Gene:Nkx1-1 / 298981 RGDID:1564874 Length:443 Species:Rattus norvegicus


Alignment Length:308 Identity:98/308 - (31%)
Similarity:123/308 - (39%) Gaps:91/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGPGSGTGS 87
            |||.|...:|.|   ||::.......|.::.                                  
  Rat   184 DSEDEAPEEDED---EDQAPEVQDVQGTEEP---------------------------------- 211

  Fly    88 GGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGG-----SGPGSGGGTSGGYA 147
              .||.||.|...||.|.||...  |:.:..|||.|..|:.....|     :|.|:.|.|..|.|
  Rat   212 --RGGSGGLGARGSGCSGAAEVE--ASPVDEAAAPGPRGNSPGAPGPPVTAAGAGNAGSTPQGAA 272

  Fly   148 -------EHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVK 205
                   :.....|||| ||||.|||||:.||..||.||:..:||||.:|.::|.:|:|:|||||
  Rat   273 VATKPKRKRTGSDSKSG-KPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTETQVK 336

  Fly   206 TWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAG-------GLGCCPSGLSS-SFSAAA 262
            .|:||||||||:||.            ..|.....|||.|       |.| .|.|||. |.|...
  Rat   337 IWFQNRRTKWKKQNP------------GADTSAPTGGGGGPGPGAGPGAG-LPGGLSPLSPSPPM 388

  Fly   263 AAAAAASNPCN----------------FLTSAAAAAIFRNVGYVHGCP 294
            .|..|...|..                ||:|.|..:.|......:|.|
  Rat   389 GAPLALHGPAGYPAHSPGGLVCAAQLPFLSSPAVLSPFVLGSQTYGAP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 31/52 (60%)
Nkx1-1XP_234082.6 Homeobox 295..347 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.