DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Alx4

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001100023.1 Gene:Alx4 / 296511 RGDID:1310201 Length:399 Species:Rattus norvegicus


Alignment Length:237 Identity:58/237 - (24%)
Similarity:94/237 - (39%) Gaps:55/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GGGGVASGLSAAAAA----------------AGVAAGLLAAAASGANGDRDANGGSGPGSGGGTS 143
            |.||..:.|.....|                .|:....|:...:||.|.:|..|...|.      
  Rat   130 GSGGHNAALQVPCYAKESNLGEPELPPDSEPVGMDNSYLSVKETGAKGPQDRAGAEIPS------ 188

  Fly   144 GGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWY 208
               ...|.....|..|.||.||.||..||..||:.|:...|..|..|..:|...:|:|.:|:.|:
  Rat   189 ---PLEKTDSESSKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWF 250

  Fly   209 QNRRTKWKRQNQL-RLEQLR----------------HQATMEKDFVVQDGGGAGGLGCC------ 250
            ||||.||:::.:. :::|:|                :.|.::....:.:.|.|..:..|      
  Rat   251 QNRRAKWRKRERFGQMQQVRTHFSTAYELPLLTRAENYAQIQNPSWIGNNGAASPVPACVVPCDP 315

  Fly   251 -PSGLSSSFSAAAAAAAAASNPCNFLTSAAAAAIFRNVGYVH 291
             |:.:|..   |....:.||:..:||:.:.|.:   :||..|
  Rat   316 VPACMSPH---AHPPGSGASSVSDFLSVSGAGS---HVGQTH 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/52 (42%)
Alx4NP_001100023.1 Homeobox 206..258 CDD:278475 22/51 (43%)
OAR 375..392 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.