DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Obox2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_038953187.1 Gene:Obox2 / 292574 RGDID:1307972 Length:326 Species:Rattus norvegicus


Alignment Length:193 Identity:44/193 - (22%)
Similarity:66/193 - (34%) Gaps:70/193 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 GGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKF-RCQ---KYLSVADRSDVAETLNL 199
            ||..:|..|.         ||.|:.||.::..|.:.|:..| .||   |.|.:    ::|..:.:
  Rat    97 GGKQTGPVAP---------RKRRKERTQYSEKQKSVLQEHFAECQYPDKKLCL----ELASLIRV 148

  Fly   200 SETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEK-----------DF---VVQDGGGAG----- 245
            :|.::|.|::|.|.|.|::|.       .:|..||           ||   :...||..|     
  Rat   149 TEKEIKVWFKNNRAKCKQKNV-------PEALPEKNGGSEAVSGSTDFPGSIAVVGGDQGEPMAT 206

  Fly   246 --------------------------GLGCC-PSGLSSSFSAAAAAAAAASNPCNFLTSAAAA 281
                                      |..|| |..|....:...|.....|.|....:..|||
  Rat   207 AILDVDSTPKLNCSQESSLDGNWTYDGAMCCLPEDLLDGNAPVTAGDFGESAPVEAQSDLAAA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 16/56 (29%)
Obox2XP_038953187.1 HOX 109..165 CDD:197696 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.