DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and tlx3b

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_739572.1 Gene:tlx3b / 266965 ZFINID:ZDB-GENE-021021-1 Length:300 Species:Danio rerio


Alignment Length:246 Identity:72/246 - (29%)
Similarity:105/246 - (42%) Gaps:57/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DRSTPDSTAAGCQQELLLSHHHRRFTHHDE----SSVESCLSATRGPG-SGTGSGGGGGGGGGGG 98
            ||: |.|:.:|..|....:.|.......|:    :..||..::||... |.:||....||....|
Zfish     2 DRA-PSSSPSGTSQTSQPTQHEPISFGIDQILSGTDQESQQNSTRNSSESSSGSSSASGGCYHLG 65

  Fly    99 VASGLSAAAAAA------GVAAGLLAAAASGANGDRDANGG--------------------SGPG 137
            ..:|.||.....      |:||....::..|.|... |.||                    :.||
Zfish    66 SPTGASATPYTTLTGTFHGIAAPYEESSPYGVNLTL-APGGVIRVPAHRPLAAAVPPPMASAVPG 129

  Fly   138 SGGGTSGGYAEHKLQLSK--------------------SGRKPRRR---RTAFTHAQLAYLERKF 179
            . |..|..:.|...:.:|                    ..|.|.:|   ||:|:..|:..||::|
Zfish   130 L-GSLSFPWMESSQRFAKDRFAAALTPFTVARRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRF 193

  Fly   180 RCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQA 230
            ..||||:.|:|:.:|:||.:::.|||||:|||||||:||.....|..|.||
Zfish   194 HRQKYLASAERAALAKTLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 28/55 (51%)
tlx3bNP_739572.1 Homeobox 177..230 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.