DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and GBX2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001476.2 Gene:GBX2 / 2637 HGNCID:4186 Length:348 Species:Homo sapiens


Alignment Length:247 Identity:74/247 - (29%)
Similarity:94/247 - (38%) Gaps:77/247 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PDSTAAGCQQELLLSHHHRRFTHHDESSVES--CLSATRG-----------PGSGTGS------- 87
            |....|..|..|..:|     .||...|:.:  |.|..:|           ||..:.|       
Human    63 PALPQAALQPALPPAH-----PHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAA 122

  Fly    88 -----------GGGG----------GGGGGGGVA--SGLSAAAAAAGVAAGLLAAA-ASGANGDR 128
                       |||.          ...|.|.:|  ..|.|.:||..|.|.|:.|. ..|.:..:
Human   123 AARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESK 187

  Fly   129 DANGGSGPG-----------SGGGTSGGYAEHKLQ-----------------LSKSGRKPRRRRT 165
            ..:...|..           |......|.|.||.:                 .:.|..|.|||||
Human   188 VEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGSTTSTGKNRRRRT 252

  Fly   166 AFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR 217
            |||..||..||::|.|:||||:.:||.:|..|.|||.|||.|:||||.||||
Human   253 AFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 32/52 (62%)
GBX2NP_001476.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139 4/27 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 11/71 (15%)
Homeobox 250..303 CDD:306543 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.