Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001476.2 | Gene: | GBX2 / 2637 | HGNCID: | 4186 | Length: | 348 | Species: | Homo sapiens |
Alignment Length: | 247 | Identity: | 74/247 - (29%) |
---|---|---|---|
Similarity: | 94/247 - (38%) | Gaps: | 77/247 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 PDSTAAGCQQELLLSHHHRRFTHHDESSVES--CLSATRG-----------PGSGTGS------- 87
Fly 88 -----------GGGG----------GGGGGGGVA--SGLSAAAAAAGVAAGLLAAA-ASGANGDR 128
Fly 129 DANGGSGPG-----------SGGGTSGGYAEHKLQ-----------------LSKSGRKPRRRRT 165
Fly 166 AFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 32/52 (62%) |
GBX2 | NP_001476.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 59..81 | 5/22 (23%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 111..139 | 4/27 (15%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 179..251 | 11/71 (15%) | |||
Homeobox | 250..303 | CDD:306543 | 32/52 (62%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |