DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and GBX1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001092304.1 Gene:GBX1 / 2636 HGNCID:4185 Length:363 Species:Homo sapiens


Alignment Length:154 Identity:60/154 - (38%)
Similarity:77/154 - (50%) Gaps:26/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SSVESCLSATRGPGSGT-----GSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDR 128
            ||.|..|.|:.|..:|:     ||||.....|      .|.::|...|        |..|.....
Human   186 SSDEEKLEASAGDPAGSEQEEEGSGGDSEDDG------FLDSSAGGPG--------ALLGPKPKL 236

  Fly   129 DANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDV 193
            ..:.|:|...|...:.|       ::..|.|.||||||||..||..||::|.|:||||:.:||.:
Human   237 KGSLGTGAEEGAPVTAG-------VTAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQI 294

  Fly   194 AETLNLSETQVKTWYQNRRTKWKR 217
            |..|.|||.|||.|:||||.||||
Human   295 AHALKLSEVQVKIWFQNRRAKWKR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 32/52 (62%)
GBX1NP_001092304.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..265 25/99 (25%)
Homeobox 264..317 CDD:306543 32/52 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.