DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and VAX2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_036608.1 Gene:VAX2 / 25806 HGNCID:12661 Length:290 Species:Homo sapiens


Alignment Length:238 Identity:81/238 - (34%)
Similarity:109/238 - (45%) Gaps:44/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RGPGSGTGSGGGGG-----GGGG-----GGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGG 133
            |||.....||||||     .|.|     ||..|....|..:|...||   :..|||    |::|.
Human    10 RGPARRAESGGGGGRCGDRSGAGDLRADGGGHSPTEVAGTSASSPAG---SRESGA----DSDGQ 67

  Fly   134 SGPGSGG--------GTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKF-RCQKYLSVAD 189
            .|||...        ...|...|..|.......:|:|.||:||..||..||.:| ||| |:...:
Human    68 PGPGEADHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQ-YVVGRE 131

  Fly   190 RSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDF-------VVQDG------ 241
            |:::|..|||||||||.|:||||||.|:.....||: |..::..:.|       :::.|      
Human   132 RTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEK-RASSSASEAFATSNILRLLEQGRLLSVP 195

  Fly   242 GGAGGLGCCPS--GLSSSFSAAAAAAAAASNP-CNFLTSAAAA 281
            .....|...||  ||.:|....:......|:| .|.|:||:|:
Human   196 RAPSLLALTPSLPGLPASHRGTSLGDPRNSSPRLNPLSSASAS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 31/53 (58%)
VAX2NP_036608.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 26/71 (37%)
Homeobox 105..158 CDD:306543 31/53 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..240 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.