DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Pax6

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_006234695.1 Gene:Pax6 / 25509 RGDID:3258 Length:436 Species:Rattus norvegicus


Alignment Length:328 Identity:80/328 - (24%)
Similarity:118/328 - (35%) Gaps:114/328 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LSNDDSDID------IEDRSTPDSTAAGCQQELLLSHHHRR--------FTHHD--------ESS 70
            :.|..|.::      :..|..||||.   |:.:.|:|...|        .||.|        |:.
  Rat     1 MQNSHSGVNQLGGVFVNGRPLPDSTR---QKIVELAHSGARPCDISRILQTHADAKVQVLDSENV 62

  Fly    71 VESCLSATRGPGSGTGS------GGGGGGGGGGGVASGLSA---------------AAAAAGVAA 114
            ...|:|...|....|||      ||.........|.|.::.               ...:.||..
  Rat    63 SNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCT 127

  Fly   115 G-----------LLAAAAS-----GANGDRD----ANG-----GSGPGSGGGTS----------- 143
            .           :|...||     ||:|..|    .||     |:.||...|||           
  Rat   128 NDNIPSVSSINRVLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQ 192

  Fly   144 --GGYAEHKLQLSKSG-------------RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDV 193
              .|..|:...:|.:|             ||.:|.||:||..|:..||::|....|..|..|..:
  Rat   193 QQEGQGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERL 257

  Fly   194 AETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSF 258
            |..::|.|.:::.|:.|||.||:|:.:||.:  |.||:.....:               .:||||
  Rat   258 AAKIDLPEARIQVWFSNRRAKWRREEKLRNQ--RRQASNTPSHI---------------PISSSF 305

  Fly   259 SAA 261
            |.:
  Rat   306 STS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 19/52 (37%)
Pax6XP_006234695.1 PAX 4..142 CDD:128645 26/140 (19%)
Homeobox 228..281 CDD:395001 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.