Protein Alignment CG11085 and Npm1

DIOPT Version :9

• Sequence 1: NP_572815.3
• Gene: CG11085 / 32213
• FlyBaseID: FBgn0030408
• Length: 295
• Species: Drosophila melanogaster
• Sequence 2: NP_037124.1
• Gene: Npm1 / 25498
• RGDID: 3192
• Length: 292
• Species: Rattus norvegicus
• Alignment Length: 38
• Identity: 11/38 - (28%)
• Similarity: 17/38 - (44%)
• Gaps: 8/38 - (21%)

  Fly    23 DSELELSNDDSDIDIED--------RSTPDSTAAGCQQ 52
            |.|.:..:||.|.|.|:        :|..|:.|...|:
  Rat   168 DDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQK 205

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG11085	NP_572815.3	Homeobox	163..216	CDD:278475
Npm1	NP_037124.1	Required for interaction with SENP3. /evidence=ECO:0000250	1..185		7/16 (44%)
		Necessary for interaction with APEX1. /evidence=ECO:0000250	1..117
		Nucleoplasmin	18..117	CDD:397268
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	138..248		11/38 (29%)
		Nuclear localization signal. /evidence=ECO:0000255	152..157
		Nuclear localization signal. /evidence=ECO:0000255	190..196		1/5 (20%)
		Required for nucleolar localization. /evidence=ECO:0000250	241..292
		NPM1-C	243..289	CDD:406641

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0488
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900