DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Obox6

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_663756.2 Gene:Obox6 / 252830 MGIID:2149036 Length:347 Species:Mus musculus


Alignment Length:77 Identity:22/77 - (28%)
Similarity:41/77 - (53%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 SGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTW 207
            |..|.:.::.| .:.||.|:.||.:|..|...|::.|....|.|...|..:|..:.::..:::.|
Mouse   129 SPSYGDRRVSL-VTPRKHRKIRTVYTEEQKCVLKKHFHKCTYPSREQRMALAVLVGVTANEIQIW 192

  Fly   208 YQNRRTKWKRQN 219
            ::|.|.|.||::
Mouse   193 FKNHRAKSKRES 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 14/52 (27%)
Obox6NP_663756.2 COG5576 86..>204 CDD:227863 22/75 (29%)
homeodomain 146..204 CDD:238039 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.