DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Tlx2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_033418.1 Gene:Tlx2 / 21909 MGIID:1350935 Length:284 Species:Mus musculus


Alignment Length:236 Identity:73/236 - (30%)
Similarity:102/236 - (43%) Gaps:72/236 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LLLSHHHRRFTHHDESS--VESCLSATRGPGSGTGSG-GGGGGGGGGGVASGLSAAAAAAGVAAG 115
            :|.:||   ..||:..|  ::..||....||.|.|.| .|...|.....:||...|:..|  .||
Mouse     5 VLAAHH---LPHHEPISFGIDQILSGPEPPGGGLGPGQSGQSHGESAAFSSGFHGASGYA--PAG 64

  Fly   116 LLAAAASGANGDRDANGGSGPG--------------------------SGGGTSGGYAEHKLQLS 154
            .||:...|:        |.|||                          ||.|.:||.|.......
Mouse    65 SLASLPRGS--------GVGPGGVIRVPAHRPLPVPPPSGAAPAVPGPSGLGGAGGLAGLTFPWM 121

  Fly   155 KSGRK----------------------------PRRR--RTAFTHAQLAYLERKFRCQKYLSVAD 189
            .|||:                            |:|:  ||:|:.:|:..|||:|..||||:.|:
Mouse   122 DSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAE 186

  Fly   190 RSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQA 230
            |:.:|:.|.:::.|||||:|||||||:||.....|..||:|
Mouse   187 RAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 27/54 (50%)
Tlx2NP_033418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..52 9/31 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..104 1/25 (4%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..166 5/25 (20%)
Homeobox 160..213 CDD:306543 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.