Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_033418.1 | Gene: | Tlx2 / 21909 | MGIID: | 1350935 | Length: | 284 | Species: | Mus musculus |
Alignment Length: | 236 | Identity: | 73/236 - (30%) |
---|---|---|---|
Similarity: | 102/236 - (43%) | Gaps: | 72/236 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 LLLSHHHRRFTHHDESS--VESCLSATRGPGSGTGSG-GGGGGGGGGGVASGLSAAAAAAGVAAG 115
Fly 116 LLAAAASGANGDRDANGGSGPG--------------------------SGGGTSGGYAEHKLQLS 154
Fly 155 KSGRK----------------------------PRRR--RTAFTHAQLAYLERKFRCQKYLSVAD 189
Fly 190 RSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQA 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 27/54 (50%) |
Tlx2 | NP_033418.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 20..52 | 9/31 (29%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 78..104 | 1/25 (4%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 140..166 | 5/25 (20%) | |||
Homeobox | 160..213 | CDD:306543 | 27/52 (52%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |