Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006526978.1 | Gene: | Tlx1 / 21908 | MGIID: | 98769 | Length: | 345 | Species: | Mus musculus |
Alignment Length: | 233 | Identity: | 67/233 - (28%) |
---|---|---|---|
Similarity: | 88/233 - (37%) | Gaps: | 86/233 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 SATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGG 140
Fly 141 GTSG----------------------GYAEHKLQLS--------------------------KSG 157
Fly 158 R------------------------------KPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSD 192
Fly 193 VAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQA 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 27/52 (52%) |
Tlx1 | XP_006526978.1 | Homeobox | 219..273 | CDD:365835 | 28/53 (53%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |