DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Nkx1-2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_033149.1 Gene:Nkx1-2 / 20231 MGIID:104806 Length:305 Species:Mus musculus


Alignment Length:333 Identity:92/333 - (27%)
Similarity:123/333 - (36%) Gaps:117/333 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SFLIRDLLGD--------------LINRRQTDSELELSNDD-SDIDIEDRSTPDSTAAGCQ---- 51
            ||.:.|:|..              .:..:::..|:|...|. |...|..:.|||:...|..    
Mouse    19 SFSVLDILDPQKFTRAALPPVRLAALEAKKSLEEVEAGQDACSGNPIGSQETPDAVGRGIDPGSP 83

  Fly    52 ------------QELLLSHHHRRFTHHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLS 104
                        ::...:|...|:....|.|.|:     |....||...|          |.||.
Mouse    84 VEGSEAEEEEEAEDAGRAHQPERWQGVHEGSPEA-----RAVAVGTEESG----------AEGLP 133

  Fly   105 AAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTH 169
            |:                             |||.|..    ...:.:...|..||||.|||||:
Mouse   134 AS-----------------------------PGSPGSP----RPRRRRAESSCAKPRRARTAFTY 165

  Fly   170 AQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEK 234
            .||..||.|||..:||||.:|.::|.:|:|:|||||.|:||||||||:||.            ..
Mouse   166 EQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNP------------GA 218

  Fly   235 DFVVQDGGGA------------GGL-----------GCCPSGLSSSFSAAAAAAAAASNPCNFLT 276
            |..||.||||            ||.           |..|.....::.|......|||.|   ||
Mouse   219 DGAVQAGGGAPQPGTPGAVAGGGGSATGSSPGPPVPGALPYQTFPTYPATNVLFPAASFP---LT 280

  Fly   277 SAAAAAIF 284
            :||..:.|
Mouse   281 TAANGSPF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 32/52 (62%)
Nkx1-2NP_033149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..158 29/154 (19%)
Homeobox 160..212 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..257 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.