DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and EN2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001418.2 Gene:EN2 / 2020 HGNCID:3343 Length:333 Species:Homo sapiens


Alignment Length:297 Identity:77/297 - (25%)
Similarity:115/297 - (38%) Gaps:106/297 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 STPDSTAAGCQQELLL--------SHHH-RRFTHHDESSVESCLSAT--RGPGSGT---GSGGG- 90
            |:|.....|.::.|:|        :|.| .|.|:.   .:::.|...  |...:||   |:||| 
Human    35 SSPGEADTGRRRALMLPAVLQAPGNHQHPHRITNF---FIDNILRPEFGRRKDAGTCCAGAGGGR 96

  Fly    91 GGGGGGGGVASGLSAAAAAAGVAAGLLAA----------AASGANGDRDANGGSGPGSG------ 139
            |||.||.|.|||......|.| :..||.:          .|.||.|...|.|...||.|      
Human    97 GGGAGGEGGASGAEGGGGAGG-SEQLLGSGSREPRQNPPCAPGAGGPLPAAGSDSPGDGEGGSKT 160

  Fly   140 ---------GGTSGGYAEHKLQL----------------SKSG---------------------- 157
                     ||..||..:..|:.                |::|                      
Human   161 LSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWPAWVYCTRYSDR 225

  Fly   158 -------RKPRRR---------RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKT 206
                   |||:::         |||||..||..|:.:|:..:||:...|..:|:.|:|:|:|:|.
Human   226 PSSGPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKI 290

  Fly   207 WYQNRRTKWKRQN--------QLRLEQLRHQATMEKD 235
            |:||:|.|.|:..        .|..:.|.:.:|..|:
Human   291 WFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 23/61 (38%)
EN2NP_001418.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 3/13 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..206 30/111 (27%)
homeobox domain 243..302 24/58 (41%)
Homeobox 247..300 CDD:306543 23/52 (44%)
Engrail_1_C_sig 302..331 CDD:313702 4/26 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.