| Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001417.3 | Gene: | EN1 / 2019 | HGNCID: | 3342 | Length: | 392 | Species: | Homo sapiens |
| Alignment Length: | 227 | Identity: | 65/227 - (28%) |
|---|---|---|---|
| Similarity: | 92/227 - (40%) | Gaps: | 69/227 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 78 TRGPGS-----------GTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDAN 131
Fly 132 GGSGPGSG--GGTSGGYAEH--------------------------------------------- 149
Fly 150 --KLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRR 212
Fly 213 TKWKR----QNQLRLEQL-----RHQATMEKD 235 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 22/52 (42%) |
| EN1 | NP_001417.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..100 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 132..164 | 2/2 (100%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 219..251 | 10/31 (32%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 282..306 | 3/23 (13%) | |||
| Homeobox | 306..359 | CDD:278475 | 22/52 (42%) | ||
| Engrail_1_C_sig | 361..390 | CDD:287495 | 6/27 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||