DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Rhox11

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_941000.1 Gene:Rhox11 / 194738 MGIID:2681831 Length:206 Species:Mus musculus


Alignment Length:151 Identity:32/151 - (21%)
Similarity:57/151 - (37%) Gaps:50/151 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 SGGYAEHKLQLSKSGRKPR-------------------------------------RRRTAFTHA 170
            |||:|:....:.|.|.:..                                     |:...||..
Mouse    36 SGGFADEVTGIPKEGHQSSIGEHSCVMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPG 100

  Fly   171 QLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR-QNQL--------RLEQL 226
            ||..|:..|...:|.....|.::|..||:.|.::|.|:.|:|.|::: |.::        ..|:|
Mouse   101 QLWELQAVFVENQYPDALKRKELAGLLNVDEQKIKDWFNNKRAKYRKIQREILGGKNITPTQEEL 165

  Fly   227 RHQATMEKDFVV----QDGGG 243
            |.:..:|...::    |:|.|
Mouse   166 RMKTLVESKKIIIFQEQEGDG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 17/52 (33%)
Rhox11NP_941000.1 Homeobox 96..146 CDD:278475 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.