DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and ceh-31

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_508525.3 Gene:ceh-31 / 191621 WormBaseID:WBGene00000452 Length:260 Species:Caenorhabditis elegans


Alignment Length:75 Identity:40/75 - (53%)
Similarity:50/75 - (66%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
            :|.|:.||.||..||..||..|..||||||.||.::|..:.|::|||||||||||||||||..:.
 Worm    92 KKARKARTIFTDKQLQELENTFEKQKYLSVQDRMELAHRMGLTDTQVKTWYQNRRTKWKRQASVG 156

  Fly   223 LEQLRHQATM 232
            ::.|.....|
 Worm   157 MDLLHDAGNM 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 32/52 (62%)
ceh-31NP_508525.3 Homeobox 98..150 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.860

Return to query results.
Submit another query.