powered by:
Protein Alignment CG11085 and ceh-31
DIOPT Version :9
Sequence 1: | NP_572815.3 |
Gene: | CG11085 / 32213 |
FlyBaseID: | FBgn0030408 |
Length: | 295 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508525.3 |
Gene: | ceh-31 / 191621 |
WormBaseID: | WBGene00000452 |
Length: | 260 |
Species: | Caenorhabditis elegans |
Alignment Length: | 75 |
Identity: | 40/75 - (53%) |
Similarity: | 50/75 - (66%) |
Gaps: | 0/75 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
:|.|:.||.||..||..||..|..||||||.||.::|..:.|::|||||||||||||||||..:.
Worm 92 KKARKARTIFTDKQLQELENTFEKQKYLSVQDRMELAHRMGLTDTQVKTWYQNRRTKWKRQASVG 156
Fly 223 LEQLRHQATM 232
::.|.....|
Worm 157 MDLLHDAGNM 166
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0488 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1387 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
4 | 3.860 |
|
Return to query results.
Submit another query.