DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and ceh-30

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_508524.2 Gene:ceh-30 / 191620 WormBaseID:WBGene00000451 Length:237 Species:Caenorhabditis elegans


Alignment Length:121 Identity:52/121 - (42%)
Similarity:60/121 - (49%) Gaps:33/121 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 ASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYL 185
            ||...|||       .||.|               |.:|.|:.||.||..||..||..|..||||
 Worm    78 ASSPGGDR-------MGSPG---------------SCKKSRKARTIFTDKQLQELENTFEKQKYL 120

  Fly   186 SVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDG 241
            ||.||.|:|..:.|::||||||||||||||||           |||...|.:.:.|
 Worm   121 SVQDRMDLAHRMGLTDTQVKTWYQNRRTKWKR-----------QATSGMDLLSEPG 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 33/52 (63%)
ceh-30NP_508524.2 Homeobox 99..151 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.860

Return to query results.
Submit another query.