DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and ceh-54

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001338798.1 Gene:ceh-54 / 188474 WormBaseID:WBGene00020485 Length:221 Species:Caenorhabditis elegans


Alignment Length:146 Identity:36/146 - (24%)
Similarity:56/146 - (38%) Gaps:34/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 KPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRL 223
            :.:|.|..|...|:..:|:.|...:|.....|..:|..:.|.|.:|:.|:||||.|::|:.    
 Worm    44 RKKRNRITFDANQIDEMEKVFAENQYPDTMSREKLANKIQLHEERVQIWFQNRRAKYRREQ---- 104

  Fly   224 EQLRH---------QATMEK----DFVVQDGGGAGGLGCCPSGLSSSFSAAAAAA---------- 265
            :|..|         ..|.||    |........:.|    ||.||:....:...|          
 Worm   105 KQTGHPYEPPSITKNPTGEKEKTQDCTTLTSASSPG----PSNLSNDTLVSIEMAPKIGTKSVNL 165

  Fly   266 ---AAASNPCNFLTSA 278
               .|.||..|.:.:|
 Worm   166 FPDQALSNTLNMIINA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 17/52 (33%)
ceh-54NP_001338798.1 Homeobox 49..102 CDD:365835 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.