DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and vab-15

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_509648.1 Gene:vab-15 / 181197 WormBaseID:WBGene00006881 Length:225 Species:Caenorhabditis elegans


Alignment Length:131 Identity:44/131 - (33%)
Similarity:70/131 - (53%) Gaps:29/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 GYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQ 209
            |.::..|:..|:.|||   ||.|:..||..|||||:.::|||:|:|::.:.:|.|:|||||.|:|
 Worm   117 GLSKCMLRKHKNNRKP---RTPFSTQQLISLERKFQSKQYLSIAERAEFSASLQLTETQVKIWFQ 178

  Fly   210 NRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASNPCNF 274
            |||.|.||..:..:|:::                          .:.:.:.||||...|.:|.:.
 Worm   179 NRRAKSKRLQEAEVEKVK--------------------------FAQASAYAAAAVGGAPDPSSI 217

  Fly   275 L 275
            |
 Worm   218 L 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 28/52 (54%)
vab-15NP_509648.1 Homeobox 132..185 CDD:278475 29/55 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.