DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Nkx2-6

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_035050.2 Gene:Nkx2-6 / 18092 MGIID:97351 Length:289 Species:Mus musculus


Alignment Length:174 Identity:52/174 - (29%)
Similarity:74/174 - (42%) Gaps:39/174 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETL 197
            |.|..||....||      .:|...|..|:.|..|:.||:..|||:|:.|:||:..:|..:|..|
Mouse   102 GVGNLSGDMRRGG------PVSTRTRPQRKSRVLFSQAQVLALERRFKQQRYLTAPEREHLASAL 160

  Fly   198 NLSETQVKTWYQNRRTKWKRQNQ-LRLEQLRHQATMEK---DFVVQDG----------------- 241
            .|:.||||.|:||||.|.|.|.| ..||...|.....:   ..:|.||                 
Mouse   161 QLTSTQVKIWFQNRRYKSKSQRQDQTLELAGHPLAPRRVAVPVLVLDGKPCLDPDVAAFLGPYKA 225

  Fly   242 -------GGAGGLGCCPSGLSSSFSAAAAAAAAASNPCNFLTSA 278
                   ||..|     :...:|:::...:|:|...|...|.|:
Mouse   226 TSPYSCFGGYAG-----TPYDASYASRCTSASAGPGPLTPLASS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 25/52 (48%)
Nkx2-6NP_035050.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..125 8/28 (29%)
Homeobox 126..179 CDD:278475 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..289 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.