DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Msx2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_038629.2 Gene:Msx2 / 17702 MGIID:97169 Length:267 Species:Mus musculus


Alignment Length:250 Identity:78/250 - (31%)
Similarity:106/250 - (42%) Gaps:75/250 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLA--------------AAASGA-- 124
            |...||....|.|.|.||..|......:..::....|.| |::              .|::||  
Mouse    13 SDEEGPAVLAGPGPGPGGAEGSAEERRVKVSSLPFSVEA-LMSDKKPPKESPAVPPDCASAGAVL 76

  Fly   125 -------NGDRDANGGSGP-------------GSGGGT-----SGGYAEHKLQLS---------K 155
                   :|.|||: ..||             .|..|.     .|.|:.....:|         |
Mouse    77 RPLLLPGHGVRDAH-SPGPLVKPFETASVKSENSEDGAPWIQEPGRYSPPPRHMSPTTCTLRKHK 140

  Fly   156 SGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220
            :.|||   ||.||.:||..||||||.::|||:|:|::.:.:|||:|||||.|:||||.|.||..:
Mouse   141 TNRKP---RTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQE 202

  Fly   221 LRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSF----SAAAAAAAAASNP 271
            ..||:|:..|   |..:             |||.|..|    ...||:...||.|
Mouse   203 AELEKLKMAA---KPML-------------PSGFSLPFPINSPLQAASIYGASYP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 31/52 (60%)
Msx2NP_038629.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 9/28 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..132 5/27 (19%)
Homeobox 145..198 CDD:306543 32/55 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.