DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and DLX4

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_612138.1 Gene:DLX4 / 1748 HGNCID:2917 Length:240 Species:Homo sapiens


Alignment Length:159 Identity:43/159 - (27%)
Similarity:66/159 - (41%) Gaps:61/159 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 GYAEHKLQLSKSGRKPR-------RR-----------RTAFTHAQLAYLERKFRCQKYLSVADRS 191
            |.|||..:|.....|||       ||           ||.::..||.:|.::|:..:||::.:|:
Human    84 GPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERA 148

  Fly   192 DVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGG---------L 247
            .:|..|.|::||||.|:||:|:|:|:                  .:.|:.||..|         .
Human   149 QLAAQLGLTQTQVKIWFQNKRSKYKK------------------LLKQNSGGQEGDFPGRTFSVS 195

  Fly   248 GCCP----------------SGLSSSFSA 260
            .|.|                ||..:||.|
Human   196 PCSPPLPSLWDLPKAGTLPTSGYGNSFGA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/63 (35%)
DLX4NP_612138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..120 10/35 (29%)
Homeobox 120..173 CDD:306543 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.