DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11085 and DLX3

DIOPT Version :9

Sequence 1:	NP_572815.3	Gene:	CG11085 / 32213	FlyBaseID:	FBgn0030408	Length:	295	Species:	Drosophila melanogaster
Sequence 2:	NP_005211.1	Gene:	DLX3 / 1747	HGNCID:	2916	Length:	287	Species:	Homo sapiens

Alignment Length:	115	Identity:	36/115 - (31%)
Similarity:	60/115 - (52%)	Gaps:	28/115 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   131 NGGSGPGSGGGTS-----------GGYAEHKL-----------------QLSKSGRKPRRRRTAF 167
            ||.:|.|:....|           |.|.|..|                 .::...:|.|:.||.:
Human    72 NGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIY 136

  Fly   168 THAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR 217
            :..|||.|:|:|:..:||::.:|:::|..|.|::||||.|:||||:|:|:
Human   137 SSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK 186

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11085	NP_572815.3	Homeobox	163..216	CDD:278475	24/52 (46%)
DLX3	NP_005211.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	20..39
		DLL_N	27..107	CDD:403572	9/34 (26%)
		COG5576	<109..232	CDD:227863	27/78 (35%)
		homeobox	129..188		26/58 (45%)
		Homeobox	132..186	CDD:395001	24/53 (45%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	195..287
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910