DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and DLX2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_004396.1 Gene:DLX2 / 1746 HGNCID:2915 Length:328 Species:Homo sapiens


Alignment Length:305 Identity:80/305 - (26%)
Similarity:124/305 - (40%) Gaps:94/305 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 HHDESSVESCLSATRGPGSGTGSGGGG-----------------------------------GGG 94
            |..:.:..|.....:.|.||.|:|.||                                   |||
Human    13 HSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGG 77

  Fly    95 GGGG-----------VASGLSAA--AAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGY 146
            ||||           .||||:..  :|.:....|..||..|.|              ..|||...
Human    78 GGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYA--------------PYGTSSSP 128

  Fly   147 AEHKLQ----------LSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSE 201
            |.::.:          ::...:|.|:.||.::..|||.|:|:|:..:||::.:|:::|.:|.|::
Human   129 ANNEPEKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQ 193

  Fly   202 TQVKTWYQNRRTKWK---RQNQLRLEQLRH--------------QATMEKDFVVQD---GGGAGG 246
            ||||.|:||||:|:|   :..::..||  |              .|....||.|..   |||..|
Human   194 TQVKIWFQNRRSKFKKMWKSGEIPSEQ--HPGASASPPCASPPVSAPASWDFGVPQRMAGGGGPG 256

  Fly   247 LGCCPSGLSSSFSAAAAAAAAASNPCNFLTSAAAAAIFRNVGYVH 291
            .|...:|.|.|..::||:|...:.|....||.:|:.:......:|
Human   257 SGGSGAGSSGSSPSSAASAFLGNYPWYHQTSGSASHLQATAPLLH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/52 (46%)
DLX2NP_004396.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..81 13/64 (20%)
DLL_N 51..132 CDD:289198 21/94 (22%)
Homeobox 155..208 CDD:278475 24/52 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..270 15/60 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..328 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.