DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and GSX2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_573574.2 Gene:GSX2 / 170825 HGNCID:24959 Length:304 Species:Homo sapiens


Alignment Length:200 Identity:60/200 - (30%)
Similarity:83/200 - (41%) Gaps:52/200 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGAN---------- 125
            |.|.|.::|| ..|.||||.|.|..|.| .||::.||.|..:..|..::|...|.          
Human    65 VTSHLHSSRG-SVGAGSGGAGAGVTGAG-GSGVAGAAGALPLLKGQFSSAPGDAQFCPRVNHAHH 127

  Fly   126 -----------------GDRDANGGSGPGSGGGTSGGYAEHKLQL-------------------- 153
                             |...|...:...:....:.|:.:|...:                    
Human   128 HHHPPQHHHHHHQPQQPGSAAAAAAAAAAAAAAAALGHPQHHAPVCTATTYNVADPRRFHCLTMG 192

  Fly   154 -SKSGRKP--RRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKW 215
             |.:.:.|  :|.|||||..||..|||:|....|||...|.::|..|||||.|||.|:||||.|.
Human   193 GSDASQVPNGKRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKH 257

  Fly   216 KRQNQ 220
            |::.:
Human   258 KKEGK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 30/52 (58%)
GSX2NP_573574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151 3/34 (9%)
Homeobox 206..258 CDD:306543 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..304
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.