Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573574.2 | Gene: | GSX2 / 170825 | HGNCID: | 24959 | Length: | 304 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 60/200 - (30%) |
---|---|---|---|
Similarity: | 83/200 - (41%) | Gaps: | 52/200 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 VESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGAN---------- 125
Fly 126 -----------------GDRDANGGSGPGSGGGTSGGYAEHKLQL-------------------- 153
Fly 154 -SKSGRKP--RRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKW 215
Fly 216 KRQNQ 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 30/52 (58%) |
GSX2 | NP_573574.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 116..151 | 3/34 (9%) | |
Homeobox | 206..258 | CDD:306543 | 30/51 (59%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 283..304 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |