DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and ARX

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_620689.1 Gene:ARX / 170302 HGNCID:18060 Length:562 Species:Homo sapiens


Alignment Length:312 Identity:84/312 - (26%)
Similarity:117/312 - (37%) Gaps:103/312 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRG-PGSGTG 86
            |.|.||..|:.|.|.|:....|.     ::|||            |....:.|...|. |.:.||
Human   225 DDEEELLEDEEDEDEEEELLEDD-----EEELL------------EDDARALLKEPRRCPVAATG 272

  Fly    87 SGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKL 151
            :           ||   :|||||.....|.|:..........||.|..|..|...::|..:|..|
Human   273 A-----------VA---AAAAAAVATEGGELSPKEELLLHPEDAEGKDGEDSVCLSAGSDSEEGL 323

  Fly   152 QLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWK 216
                ..||.||.||.||..||..|||.|:...|..|..|.::|..|:|:|.:|:.|:||||.||:
Human   324 ----LKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWR 384

  Fly   217 RQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSG---------------------------- 253
            ::.:                        .|....|.|                            
Human   385 KREK------------------------AGAQTHPPGLPFPGPLSATHPLSPYLDASPFPPHHPA 425

  Fly   254 LSSSFSAAAAAAAAA---------------SNPCNFLTSAAAAAIFRNVGYV 290
            |.|:::|||||||||               |.....|::...||:||:..::
Human   426 LDSAWTAAAAAAAAAFPSLPPPPGSASLPPSGAPLGLSTFLGAAVFRHPAFI 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/52 (46%)
ARXNP_620689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..81
GCG-encoded polyalanine repeat 102..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..255 13/46 (28%)
Homeobox 332..385 CDD:395001 25/52 (48%)
OAR 526..544 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 530..543
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.