DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Lhx9

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001036042.1 Gene:Lhx9 / 16876 MGIID:1316721 Length:397 Species:Mus musculus


Alignment Length:182 Identity:46/182 - (25%)
Similarity:67/182 - (36%) Gaps:44/182 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LAAAASGA-----NGDRDANGG-----SGPGSG-------GGTSGGYAEH---KLQLSKSGRKPR 161
            |||.:.|.     ||......|     ..|..|       .|.:...|:|   ..|.....:|.:
Mouse   204 LAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNENEADHLDRDQQPYPPSQKTK 268

  Fly   162 RRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQL 226
            |.||:|.|.||..::..|.........|...:|:...|::..::.|:||.|.|::| |.||    
Mouse   269 RMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR-NLLR---- 328

  Fly   227 RHQATMEKDFVVQDGGG---AGG--LGCCPSGLSSSFSAAAAAAAAA--SNP 271
                        |:.||   |.|  |...||..|.:.:....|....  :||
Mouse   329 ------------QENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 15/52 (29%)
Lhx9NP_001036042.1 LIM1_Lhx2 61..124 CDD:188853
LIM2_Lhx2_Lhx9 129..187 CDD:188763
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..272 5/23 (22%)
Homeobox 271..323 CDD:278475 15/51 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 330..365 9/34 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.