DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Lbx2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_034822.1 Gene:Lbx2 / 16815 MGIID:1342288 Length:195 Species:Mus musculus


Alignment Length:136 Identity:46/136 - (33%)
Similarity:64/136 - (47%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 PGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLS 200
            ||.|.|.               |:.|:.|||||..|:..|||:|..||||:.::|..:|..|.|:
Mouse    75 PGPGAGV---------------RRRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLAARLGLA 124

  Fly   201 ETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAA 265
            ..||.||:||||.|.||.    :|::|..       |....|.:.|:.|.|:...|:.|.....:
Mouse   125 NAQVVTWFQNRRAKLKRD----VEEMRAD-------VASLCGLSPGVLCYPALPDSTSSPDPGPS 178

  Fly   266 AAASNP 271
            ...|.|
Mouse   179 GPDSEP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 27/52 (52%)
Lbx2NP_034822.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 6/28 (21%)
Homeobox 87..140 CDD:278475 27/52 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..195 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.