DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Lbx1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_034821.2 Gene:Lbx1 / 16814 MGIID:104867 Length:282 Species:Mus musculus


Alignment Length:212 Identity:63/212 - (29%)
Similarity:83/212 - (39%) Gaps:70/212 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AAGLLAAAASGANGDRDANGG-----------------------------------SGPGSGGGT 142
            ||.|||||      |:.|.||                                   :..|..|.|
Mouse    56 AAHLLAAA------DKHAPGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMT 114

  Fly   143 SGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTW 207
            ..|..:       :.:|.|:.|||||:.|:..||::|..|||||.|||..:|:.|.|:..||.||
Mouse   115 IFGQRQ-------TPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITW 172

  Fly   208 YQNRRTKWKRQNQLRLEQLRHQ------------------ATMEKDFVVQDGGGAGGLGCCPSGL 254
            :||||.|.||.    ||:::..                  |.:|::.....|||.||.|...|..
Mouse   173 FQNRRAKLKRD----LEEMKADVESAKKLGPSGQMDIVALAELEQNSEASGGGGGGGCGRAKSRP 233

  Fly   255 SSSFSAAAAAAAAASNP 271
            .|......|..|....|
Mouse   234 GSPALPPGAPQAPGGGP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 29/52 (56%)
Lbx1NP_034821.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Homeobox 128..182 CDD:395001 29/53 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..282 12/41 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.