Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034821.2 | Gene: | Lbx1 / 16814 | MGIID: | 104867 | Length: | 282 | Species: | Mus musculus |
Alignment Length: | 212 | Identity: | 63/212 - (29%) |
---|---|---|---|
Similarity: | 83/212 - (39%) | Gaps: | 70/212 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 113 AAGLLAAAASGANGDRDANGG-----------------------------------SGPGSGGGT 142
Fly 143 SGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTW 207
Fly 208 YQNRRTKWKRQNQLRLEQLRHQ------------------ATMEKDFVVQDGGGAGGLGCCPSGL 254
Fly 255 SSSFSAAAAAAAAASNP 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 29/52 (56%) |
Lbx1 | NP_034821.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..36 | ||
Homeobox | 128..182 | CDD:395001 | 29/53 (55%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 210..282 | 12/41 (29%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |