DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and NKX2-3

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_660328.2 Gene:NKX2-3 / 159296 HGNCID:7836 Length:364 Species:Homo sapiens


Alignment Length:327 Identity:92/327 - (28%)
Similarity:121/327 - (37%) Gaps:116/327 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 STPDSTAAGCQQELLLSHHHRRF---------THHDESSVESCLSATRGPGSGTGSGGGGGGGGG 96
            |||.|.    :..|.|...|:.|         .||..|:  .|:.|. ..|:....||.......
Human     9 STPFSV----KDILNLEQQHQHFHGAHLQADLEHHFHSA--PCMLAA-AEGTQFSDGGEEDEEDE 66

  Fly    97 GGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYA------------EH 149
            |...|.|::.|||                        .|.|..|....||.            ||
Human    67 GEKLSYLNSLAAA------------------------DGHGDSGLCPQGYVHTVLRDSCSEPKEH 107

  Fly   150 K-------------LQLSKS--------------GRKPRRR---RTAFTHAQLAYLERKFRCQKY 184
            :             .||.||              ..|||.|   |..|:.||:..|||:|:.|:|
Human   108 EEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRY 172

  Fly   185 LSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQA------TMEKDFVVQDG-- 241
            ||..:|..:|.:|.|:.||||.|:||||.|.|||.|.:..:|...|      .:....:|:||  
Human   173 LSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKP 237

  Fly   242 ---------GGAGGLGCCPSGLSS------SFSAAAAAAAAASNPCNFLTSAAAAAIFRNVGYVH 291
                     |....:|......:|      ..||||||||||        :|||||.:.:   .:
Human   238 CVTPSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAAAAAAAA--------AAAAAAAYSS---SY 291

  Fly   292 GC 293
            ||
Human   292 GC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 27/55 (49%)
NKX2-3NP_660328.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..153 4/20 (20%)
HOX 148..204 CDD:197696 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.