DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Hoxc4

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_038581.2 Gene:Hoxc4 / 15423 MGIID:96195 Length:264 Species:Mus musculus


Alignment Length:249 Identity:63/249 - (25%)
Similarity:97/249 - (38%) Gaps:60/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GCQQELLLSHHHRRF-------THHDESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAA 106
            |..:|....|||:..       ..:.|... ||.| .:|||:....|....|......:..|...
Mouse    38 GRTRESGFQHHHQELYPPPPPRPSYPERQY-SCTS-LQGPGNSRAHGPAQAGHHHPEKSQPLCEP 100

  Fly   107 AAAAGVAAGLLAA--AASGANGDRDANGGS-----------------GPGSGGGTSGGYAEHKLQ 152
            |..:|.:|....|  |.|....|..::..|                 .|...||           
Mouse   101 APLSGTSASPSPAPPACSQPAPDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGG----------- 154

  Fly   153 LSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR 217
                  :|:|.|||:|..|:..||::|...:||:...|.::|.:|.|||.|:|.|:||||.|||:
Mouse   155 ------EPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKK 213

  Fly   218 QNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASNP 271
            .::|...::|               .|...|..||.||::....:...:.::.|
Mouse   214 DHRLPNTKVR---------------SAPPAGAAPSTLSAATPGTSEDHSQSATP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/52 (46%)
Hoxc4NP_038581.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..130 22/93 (24%)
Antp-type hexapeptide 135..140 0/4 (0%)
Homeobox 159..213 CDD:365835 25/53 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..264 9/54 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.