DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Hlx

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_032276.1 Gene:Hlx / 15284 MGIID:96109 Length:476 Species:Mus musculus


Alignment Length:184 Identity:44/184 - (23%)
Similarity:68/184 - (36%) Gaps:63/184 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
            ||....|..|::.|...||::|..|||::..||..:|..|.|::.|||.|:||||.||:...:.:
Mouse   271 RKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQ 335

  Fly   223 LEQLRHQATMEK---------------------------------DFVVQD-------------- 240
            .::.:.:...||                                 |....|              
Mouse   336 AQKDKDKEAGEKPSGGVPAEGEREERSPSRSEGEAESESSDSESLDMAPSDTERTEGTERSLHQT 400

  Fly   241 ----GGGAGGL---GCCPSGLSSSFSAAAA---------AAAAASNPCNFLTSA 278
                ...||.|   ....||.|.|||:.::         :|::....|:.|.||
Mouse   401 TVIKASAAGALITASSSTSGSSFSFSSTSSLGSGNTHVGSASSLGGNCSELPSA 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 23/52 (44%)
HlxNP_032276.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..169
COG5576 224..>341 CDD:227863 26/69 (38%)
Homeobox 276..329 CDD:278475 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..401 5/72 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..476 11/42 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.