DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and En1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_034263.2 Gene:En1 / 13798 MGIID:95389 Length:401 Species:Mus musculus


Alignment Length:310 Identity:78/310 - (25%)
Similarity:111/310 - (35%) Gaps:117/310 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PDSTAAGCQQELLLSHHHRR------------FTHHDESSVESCLSATRGPGSGTGSGGG----- 90
            |...||...|....:..||.            |....|..:...|.|:...|.|..:|||     
Mouse    87 PQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPLPQLLVASAAAGGGAAAGGGSRVER 151

  Fly    91 --GGGGGG-------GGVASG----------------------------------LSAAAAAAGV 112
              |..|.|       |..|||                                  .:||||||..
Mouse   152 DRGQTGAGRDPVHSLGTRASGAASLLCAPDANCGPPDGSQPATAVSAGASKAGNPAAAAAAAAAA 216

  Fly   113 AAGLLAAAASGANGDRDANGGSG--PGSGGGTSGGYAEH-------------------------- 149
            ||..:||||:.|:...|:.||||  .||.|.....:.||                          
Mouse   217 AAAAVAAAAAAASKPSDSGGGSGGNAGSPGAQGAKFPEHNPAILLMGSANGGPVVKTDSQQPLVW 281

  Fly   150 --------------------KLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVA 194
                                ||:..|:.::.:|.|||||..||..|:.:|:..:|::...|..:|
Mouse   282 PAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLA 346

  Fly   195 ETLNLSETQVKTWYQNRRTKWKR----QNQLRLEQL-----RHQATMEKD 235
            :.|:|:|:|:|.|:||:|.|.|:    :|.|.|..:     .|..|..:|
Mouse   347 QELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQD 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/52 (42%)
En1NP_034263.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..167 8/28 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..253 8/23 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..315 3/21 (14%)
Homeobox 315..368 CDD:278475 22/52 (42%)
Engrail_1_C_sig 370..399 CDD:287495 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.